SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3218.JGI179889 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI179889
Domain Number 1 Region: 1-87
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 8.5e-30
Family Ribosomal L11/L12e N-terminal domain 0.0000246
Further Details:      
 
Domain Number 2 Region: 76-147
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 1.31e-16
Family Ribosomal protein L11, C-terminal domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI179889
Sequence length 165
Comment (Physcomitrella patens)
Sequence
MPPKLDPSQIVEVYVRVTGGEVGAASSLAPKIGPLGLSPKKVGEDIAKETAKDWKGLRVT
VKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKRVKNIKHNGNISLDDVIEIAKIIIQW
SMAKHAAGTVKEILGTCVSVGCTVDVKDPKEVQEGIDDGEVEIPE
Download sequence
Identical sequences A9RZZ0
3218.JGI179889 PP1S38_288V6.1 jgi|Phypa1_1|179889|estExt_gwp_gw1.C_380177 XP_001759613.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]