SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3218.JGI182782 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI182782
Domain Number 1 Region: 176-254
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000076
Family Eukaryotic type KH-domain (KH-domain type I) 0.0023
Further Details:      
 
Domain Number 2 Region: 270-301
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000157
Family CCCH zinc finger 0.0014
Further Details:      
 
Domain Number 3 Region: 118-148
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000101
Family CCCH zinc finger 0.0021
Further Details:      
 
Domain Number 4 Region: 49-73
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000314
Family CCCH zinc finger 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI182782
Sequence length 306
Comment (Physcomitrella patens)
Sequence
MSSAKTSSPLCAVSRKTNKTYHVPVNHVSNTNNIIVLDNVDNKDGSSGNRTKPCTKFFST
SGCPYGEGCHFLHFVPGGVQSMGGLAPLANISSMGGGGARKVVGGVGLDDQGANLGGFKT
RLCNRFDTPEGCRFSDKCHFAHGEKELRKFGSGGPGGRDREASRFGSYREPTPPGMAAAN
SFGASSTAKISIEASLAGAIIGKGGINAKQICRLTGAKLSIKEHETDAGLRNVEMEGSFE
QIKQASQMVRHVLIHRDSVPARPPAGAVSHNFKTKLCENFSKGTCTFGERCHFAHGAEDL
RDPYRS
Download sequence
Identical sequences A9S9S2
jgi|Phypa1_1|182782|estExt_gwp_gw1.C_590273 3218.JGI182782 XP_001763151.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]