SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3218.JGI187707 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI187707
Domain Number 1 Region: 127-291
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 5.1e-43
Family Pentapeptide repeats 0.00021
Further Details:      
 
Domain Number 2 Region: 3-105
Classification Level Classification E-value
Superfamily POZ domain 9.62e-27
Family Tetramerization domain of potassium channels 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI187707
Sequence length 295
Comment (Physcomitrella patens)
Sequence
MPSVVHLNVGGMMFATTVDTLTQRDTDSMLAVMFSGRHRLHMDSKEGAVFIDRDGTHFRH
ILNWLRDGVIPMLEISAYQELHREAEYYQLMGLVENITPFLCKKDEDDNTKPEMSRRDVI
KCLQFGKMRLRGVNLSGQNLSKLDLSNVDLSYTHLINTFFSRAKLHNSDFTGSEANGANF
HYADLFSSQFSGAGMVGAVLAGANLQSANLADARLMNASFCNANLRSAHLQNADLTNANL
SEANLENANLKGTKLSGANLRGANLQRAYLRDVNLRDTILEGALLNGANLQGAIR
Download sequence
Identical sequences A9SRT1
3218.JGI187707 XP_001769077.1.60028 jgi|Phypa1_1|187707|estExt_gwp_gw1.C_1090059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]