SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3218.JGI214555 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI214555
Domain Number 1 Region: 4-64
Classification Level Classification E-value
Superfamily Ribosomal protein L29 (L29p) 1.57e-16
Family Ribosomal protein L29 (L29p) 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI214555
Sequence length 123
Comment (Physcomitrella patens)
Sequence
MAKIKVHELRAKSKNELLSQLKELKAELAALRVAKVTGGAPNKLSKIKVVRLSIAQVLTV
ISQTQKASLREAYSKKKYLPIDLRPKKTRAIRRRLTKHQSSMKTEKQKKKEAYFPMRKFA
VKA
Download sequence
Identical sequences A9SPV0
PP1S102_67V6.1 jgi|Phypa1_1|214555|estExt_Genewise1.C_1020034 3218.JGI214555 XP_001768416.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]