SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3218.JGI223885 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI223885
Domain Number 1 Region: 2-484
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.96e-151
Family Calponin-homology domain, CH-domain 0.00000000000572
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI223885
Sequence length 526
Comment (Physcomitrella patens)
Sequence
MYLEKDPVLQRVLPIDPSTNQLFDIIKDGILLCKLINVAVAGTIDERAINMKEKLNPWER
IENHTLCLNSAKAIGCSVVNIGTQDLGDGRPHLVLGLISQIVKIQLLATVNLKQTPELAE
LLDETEEFDELWSMPAEKILLRWMNFHLKKAGHKKTVSNFTTDVKDATAYCLLLNQLAPE
SCSLDPLHIEDVYERSKAVLAQAERINCRKYITPKDLVEGSANLNLAFVAHLFHTKNGLT
QDTSKYDYAELLQDDEYKEASREERMYRTWINSQGTETFVSSLFEDVRDGWVLLEALDKV
APGSVNWKSATRPPIKWPFKKVENCNQVVDIGKRLKFSLVNIAGLDIVQGQRKLILAYLW
QLMRFSMLQLLKDLKLHGREVSDADIIHWANLKVRNVGKTSRMENFKDKSLSTGLFFLDL
LGAVEPRVVNWTLVTRGVTDEEKRVNATYIISIARKLGCSVFLLWDDIVEVRPKMILTLT
ASIMLWNLANKASKESETSASLGKWAAAVSKIDATNKFGNSLRTSV
Download sequence
Identical sequences A9TNA2
3218.JGI223885 jgi|Phypa1_1|223885|estExt_Genewise1.C_2710039 XP_001780076.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]