SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3218.JGI36893 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI36893
Domain Number 1 Region: 3-171
Classification Level Classification E-value
Superfamily Acid proteases 3.47e-36
Family Pepsin-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI36893
Sequence length 174
Comment (Physcomitrella patens)
Sequence
HLEFTPLLKHPLVETFYFVNLVAVAVNGAKLPISSKVLKMNSEGNGGAILDMSTRFTRFP
NSAFDHLVKALKALIRLPTMVVPRFQLCYSTVNTGTLIIPTVTLIFENGVRMRLPMENTF
VSVTEQGDVMCLAMVPGNPGTATVIGSAQQQNFLIVIDREASRLGFAPLQCASS
Download sequence
Identical sequences A9RRJ4
3218.JGI36893 XP_001756738.1.60028 jgi|Phypa1_1|36893|gw1.24.139.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]