SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3218.JGI43419 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI43419
Domain Number 1 Region: 98-185
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000095
Family Eukaryotic type KH-domain (KH-domain type I) 0.0019
Further Details:      
 
Domain Number 2 Region: 274-345
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000127
Family Eukaryotic type KH-domain (KH-domain type I) 0.0017
Further Details:      
 
Domain Number 3 Region: 6-65
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000228
Family Eukaryotic type KH-domain (KH-domain type I) 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI43419
Sequence length 355
Comment (Physcomitrella patens)
Sequence
KKWAGWPGDNVFRLIVPVQKVGGIIGRKGEFVKRMCEETRSRIKILEGVPGTAERIVMVS
AREDPEAAISPAMEGLLRVHRRVIEGAEPESADAEIAPGGAPVSSRLLVAATQAGSLIGR
QGATIKSIQDSSGATVRVLPAAEELPLCALADDRVVEVTGEPRNVQRATELVVAHLRKFL
VDRSVLPLFELNRAVANQSNQQSTASQWQQPSSTQQQQPPNYSSNDSSYYGAAELPHHSQ
PQQQSHDLANHHHGLSLYGRDPTLGGTIVPPTPAPVITQVTQHMQIPLSYADAIIGGAGA
NISYMRRTSGATITIQETRSVPGEMTVEIHGSASQVQTAQQLIQVKCRLWRDRGR
Download sequence
Identical sequences A9S676
jgi|Phypa1_1|43419|gw1.51.212.1 3218.JGI43419 XP_001761826.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]