SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3218.JGI46450 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI46450
Domain Number 1 Region: 6-76
Classification Level Classification E-value
Superfamily Chaperone J-domain 5.36e-21
Family Chaperone J-domain 0.0015
Further Details:      
 
Domain Number 2 Region: 91-140
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.0000361
Family Single 4Fe-4S cluster ferredoxin 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI46450
Sequence length 220
Comment (Physcomitrella patens)
Sequence
DVIGEDFYSVLGLTPDATQEEIKKAYYSCMKACHPDLSGNNSDSTDFCMFVNEIYEVLSD
PEQRMVYDEINGYALTSANPFLFPKQERDHAFVDEFTCIGCKNCANVASDTFEIEEEYGR
ARNLHDFGSPVDCIHWVTAAQLTLLEDEMRRVERVNVGMMLSGMGYQSPDVFAQASWRWE
KRQAKAMEQARIRMMKEKGKDAFGAWWQGWSNPGGDEDFR
Download sequence
Identical sequences A9S0S5
jgi|Phypa1_1|46450|gw1.40.174.1 XP_001760033.1.60028 3218.JGI46450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]