SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3218.JGI47830 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI47830
Domain Number 1 Region: 1-58
Classification Level Classification E-value
Superfamily DNA-binding domain 1.7e-21
Family GCC-box binding domain 0.00033
Further Details:      
 
Weak hits

Sequence:  3218.JGI47830
Domain Number - Region: 61-85
Classification Level Classification E-value
Superfamily CO dehydrogenase ISP C-domain like 0.00249
Family CO dehydrogenase ISP C-domain like 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI47830
Sequence length 138
Comment (Physcomitrella patens)
Sequence
YKGVRMRTWGKWVSEIREPNKRSRIWLGSFPTAEMAAKAYDAAVVCLRGPSATLNFPDCP
PSNLCRCTAPRDVQAAAAAAAAACAPLTESTESTPQSPGTASSEVETGSHHDSSSDGATK
DSFQCSTPTTSQPNSMAM
Download sequence
Identical sequences A9TNV4
jgi|Phypa1_1|47830|gw1.276.83.1 XP_001780289.1.60028 3218.JGI47830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]