SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3218.JGI51664 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI51664
Domain Number 1 Region: 253-327
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.7e-18
Family Ubiquitin-related 0.0015
Further Details:      
 
Domain Number 2 Region: 77-150
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000145
Family Ubiquitin-related 0.0022
Further Details:      
 
Domain Number 3 Region: 2-63
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000368
Family Ubiquitin-related 0.0036
Further Details:      
 
Domain Number 4 Region: 154-240
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000137
Family Ubiquitin-related 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI51664
Sequence length 334
Comment (Physcomitrella patens)
Sequence
RSIQIDASPKNTVLAVKKAIEGSEIIGASLQRLSYGGRLLKDERALEDYQIDNTSTLQMW
WCKCMACRALSADQTFHTMRIYVATHRDQTIPLTVCRNGSVYSVKAMVREEEGTPAGRQR
LIFNDEELRNGKTLNECNVAKDCVLRMAPTEPVGLMPVMVCIAILDRTISLEVRKTDTIR
DVKAVLHQVEGIPPYHQRLKLRYGYGFFNRDMNNADLPDDITLGELNVNRGDSFFLLRRQ
KHLPDCPCFECFGSSFHFFVKTVAGKSLVIDLKSFHTVDDIKRKIQSKEGIAAHKQKLLF
GDVELQDDKTLFEYGIEVDSILRLMVVSGGKSSF
Download sequence
Identical sequences A9SCJ9
jgi|Phypa1_1|51664|gw1.65.266.1 3218.JGI51664 XP_001764018.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]