SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3218.JGI56938 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI56938
Domain Number 1 Region: 5-65
Classification Level Classification E-value
Superfamily POZ domain 4.71e-21
Family BTB/POZ domain 0.00054
Further Details:      
 
Domain Number 2 Region: 80-130
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 0.0000000131
Family Skp1 dimerisation domain-like 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI56938
Sequence length 132
Comment (Physcomitrella patens)
Sequence
MAEQRVKLRSSDDEMFEVDEAVAFESQAVKNMIEDTGKDAVIPLPNVSSKILAKVIEYCK
YHVDNQKQGEDKPPASEDEIKAWDADFVKVDQATLFDLILVRNWASVWFNIKNDFTPEEE
EEVRRENQWAFE
Download sequence
Identical sequences A9S5D7
jgi|Phypa1_1|56938|fgenesh1_pm.scaffold_49000019 3218.JGI56938 XP_001761524.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]