SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3218.JGI64938 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI64938
Domain Number 1 Region: 25-170
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.22e-20
Family Calponin-homology domain, CH-domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI64938
Sequence length 380
Comment (Physcomitrella patens)
Sequence
MEASIPPQPTTSSSSRGYSSSASFRESDVEFLQTEAREWLEAVLEEKLDPHTSLQDLLAD
GTILYRISLIVKENLGKLKGNAANRPAAAVPSPDVNRTRTSLKYQPYSYVEAFLKVCKDV
GLLDLDLFNPSDAVDKKDIRHVCVCLLRLSKKARTLNIHLPDFDNPKHTLLSPPPKHLMP
SDVVHNLRDSLQQPSNGPASAKSNIILDLDKEISSSAADLSMGDSESNSVSPEVDSRGLQ
QPRNALQDPENVGDFSGDLSAMEPKDLDEYVRPVNHNGLSEKPQPVVELGIGTLKASQSP
RKSPDALEQYGAKEKGMSRNPKGRYSWFPYAAGVVFVGVLVVMVVARERRRPSLGVYEVQ
PTDSLAEISRRTGNATWQEL
Download sequence
Identical sequences A9RE77
PP1S4_106V6.1 PP1S4_106V6.2 XP_001752388.1.60028 3218.JGI64938 jgi|Phypa1_1|64938|fgenesh1_pg.scaffold_4000053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]