SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3218.JGI73629 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI73629
Domain Number - Region: 99-193
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0311
Family Calponin-homology domain, CH-domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI73629
Sequence length 403
Comment (Physcomitrella patens)
Sequence
MDVPQDELPLLYTWSLVGLLGPYPKAKRAAHALIRQQFICRGMPGEVLGEPVLDPMISLA
GCVSVCPVRHGYGILWINKNVNVRVEHVMSWPFVAHITLNQIDGIPLSRPKRNISRDFSD
AVLAAEVVAHYCPRLVDVHNYSAANGLAQKIYNWSTLNNKVFRRLHFTLTKEDIEAVASC
EPQMIERILKLLKYKIAKYRPNGLNGDSDPVKEPSDGGHCHEFHDHRSTRHPNPQRELFP
RFGQTQQSQVKDVVSQGQEYLPEPECTKRNMWVGRRGSQEQYSTSRTSSPHRGCNSQELG
LMNAKLEEKNIYIRELGETIELLEAKVRKLEQLLRLKEHKIQVLSGKIPKQNVVTSVRYN
SLNAKEHFELDIDLESYWDRLTLAAAVVDRQSGLLDMCACLSK
Download sequence
Identical sequences A9S296
3218.JGI73629 XP_001760481.1.60028 jgi|Phypa1_1|73629|fgenesh1_pg.scaffold_42000187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]