SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3218.JGI73914 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI73914
Domain Number - Region: 188-210
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0837
Family Retrovirus zinc finger-like domains 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI73914
Sequence length 216
Comment (Physcomitrella patens)
Sequence
MAVKDEFIETVSESKDPADTWQALKNIFEAGNSSQILLLSTKLHNMRMVKGGSIEEYLQT
SRDLKSNLVATGHNIVDETLVQLTLNGFPLSYEGIIQSLIVVDKLPTFAMISSKLLSESH
CLELRKNRLGEEDTLHTHFQENHTHSRYQNSDYDMYRNHNIQISNNYSTGAQFRGNSRGY
QREPFHTNQRKNFRCYVCGSPDDPARLCRNKNTAHK
Download sequence
Identical sequences jgi|Phypa1_1|73914|fgenesh1_pg.scaffold_44000121 3218.JGI73914 XP_001760698.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]