SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3218.JGI76189 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI76189
Domain Number - Region: 90-175
Classification Level Classification E-value
Superfamily Acid proteases 0.000289
Family Retroviral protease (retropepsin) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI76189
Sequence length 177
Comment (Physcomitrella patens)
Sequence
MRALVQDYLKEHETAARESASYGGRVDDDLGGSTETIYKNEEEVDIGYKQLKNEKNGYNQ
RVCFEDYSNKEMETLSHYTRKYWARATTEVLVKVGDKEEPIVVLVDHGSEINLMSKDLYK
KQKWPIDMEHGWAIRAANNTWGELYGTCPDVKIRIGDVATKQYFFVQDTMPYPLILG
Download sequence
Identical sequences A9S928
jgi|Phypa1_1|76189|fgenesh1_pg.scaffold_57000097 3218.JGI76189 XP_001762887.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]