SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3218.JGI86942 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI86942
Domain Number - Region: 188-225
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0628
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI86942
Sequence length 272
Comment (Physcomitrella patens)
Sequence
MARRWRRKKKRENRRNGHRLGNRSLRIARKSNYFALLFVVVVHSGRWRWHGIHDIPMGTT
SGRGFSRFMRHLRLRRSKMPAEKEGFEGAAYVPPESPEMRIGEFPEFYLPQVESMSALSS
AFQPPWEDWPAWPPPLSWQYPEPIDALHDASCAPHQLPYNVEMCYGPPNPWIWPDPPKLQ
NPHKDLPVREYLMIEKVYDLCLEAMKLIVIERPERPVKYVALYIREKNPLACKVKCRRHV
GDTCHCKILPTPSPPPQPEPEPGKVEANEEPK
Download sequence
Identical sequences A9T1S2
jgi|Phypa1_1|86942|fgenesh1_pg.scaffold_152000042 3218.JGI86942 XP_001772535.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]