SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3218.JGI89242 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI89242
Domain Number - Region: 36-101
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.0224
Family Insect pheromone/odorant-binding proteins 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI89242
Sequence length 256
Comment (Physcomitrella patens)
Sequence
MDFLKDFWEEFLVGSLLKDKQQQSNDQKEALTTKALQAVVNKIDQFDGRNISRYLRCYVR
EMELNRISEKKMVALFGLATIPEIRDHITSITDHCGNSWEDFSHALKDEYFLDDADRVTK
KLFLGWIERPNKNLQAIELLREFERQYSQLSKVEKLTLEPNKVDLFLQAADGELQGKLEL
LLEDKEENEGLTTKWKNVEDAVGLLTKKERRKDRSNISKTVQTPKAPVRTTLPTMPTVQP
STSLSKKADMDMEEII
Download sequence
Identical sequences A9T7S4
3218.JGI89242 XP_001774711.1.60028 jgi|Phypa1_1|89242|fgenesh1_pg.scaffold_180000051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]