SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3218.JGI90843 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI90843
Domain Number - Region: 135-220
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00188
Family Myosin rod fragments 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI90843
Sequence length 223
Comment (Physcomitrella patens)
Sequence
MAQMGASLAIDGNHWPQLVVNFEAGRSGGLRTEVSSWAKVRSLVSFAKLLASSHLQRCLY
RLICKAACVVSFTTLLVSSHLQSCLCRLICNAAYIVSFASTRSARNSSLASCCTLVSVNI
ASAGVDKSLAKRKHSVGEEIREVEQRVRGVEEEIRELVQKIGRVEEDITKLEQKIEKVEE
QINTCSDFQEKTQLRSKEDRLQDEKARLLGEKAQLRSKEENIA
Download sequence
Identical sequences A9TC56
XP_001776186.1.60028 jgi|Phypa1_1|90843|fgenesh1_pg.scaffold_202000021 3218.JGI90843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]