SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3218.JGI91055 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI91055
Domain Number 1 Region: 9-92
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000237
Family Calponin-homology domain, CH-domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI91055
Sequence length 505
Comment (Physcomitrella patens)
Sequence
MGGSTGVRRDVLRWLVALNLSFPIKNIKRDFSNGFLVAEIFSRYFPREIKMHSYDYGTKN
EKKTDNWAQLQKFFKKISFMILKDEVETIVKCQTPDGAGPLLERISKPEEGKIEKQERQH
QQNSTVNSESAKMSSAPVSARMDICKLSRDTHIESNRINMPNETCSTISAPSNGKSPGSP
CLSFNCQHFIYENNSFHPIQREAADHSPKQENRSGVLLPLQSNISFSDYGECMNQFKGKN
DYFPTPLLKRINCKDENHEKVGEKVVLSAVERARQREICENPNFQHKMVDGDHVETTKPS
SKTTSNIALAFRSHHRQRKFKQYTLNDYRRQQSAACVQLGKLGPDLEDEELGEKVNVMKR
TKTPPLSKRQKALEFAATVPKPKVKKVEVEKLPTPEKNHHQLSELQILEAKHEADRQHVE
SNNLCLDIMRGTSMKGGVAHCIQHCCGFWIGKENEYRLSPSEVYSKVITVERKKERKKHL
RNRDEASTMRGKQRLWGRIGLPRKL
Download sequence
Identical sequences A9TCQ7
XP_001776384.1.60028 jgi|Phypa1_1|91055|fgenesh1_pg.scaffold_205000015 3218.JGI91055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]