SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3218.JGI91716 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI91716
Domain Number - Region: 17-110
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00361
Family BAR domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI91716
Sequence length 168
Comment (Physcomitrella patens)
Sequence
MENENKNLEGASSGASSKGQGIYMDPSVAEIREHITSIMEHYGNSWEIFSHALKDEYFLE
DNDRVTKKLFLEWIKRPKKNLQALELLRKFERQYFQLSKVEKLTLEPNKVELFLQAADGE
LQEKLELFLEDKEEDEGLTTKWKNVENVVDLLAKREKRKDRSNISKAV
Download sequence
Identical sequences A9TEH8
jgi|Phypa1_1|91716|fgenesh1_pg.scaffold_214000004 XP_001777011.1.60028 3218.JGI91716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]