SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3218.JGI93266 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI93266
Domain Number 1 Region: 181-291
Classification Level Classification E-value
Superfamily POZ domain 1.99e-24
Family BTB/POZ domain 0.0089
Further Details:      
 
Weak hits

Sequence:  3218.JGI93266
Domain Number - Region: 117-145
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0224
Family Ran binding protein zinc finger-like 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI93266
Sequence length 360
Comment (Physcomitrella patens)
Sequence
MGGVVSPTEDRVDGRNLTPFLVVGSDADSHRVGDPELGILGESSEGSIRFIACWIRCCRG
SLPWDITLVSWVCEGAAEMLDNWNRELNYRKLMDGGRGAGAGDGAVPAAAAAEAVTVDLS
MCNQCGNLIENTVTYCHACYDLRSESDFRNERRWRELEGDFMVVEADLHKERAATKRLEG
ALQSFRHMLLQGIHADVTIETGEFDRTPAHRAVLASRSPVFRAMFEHELKEKTCAHIHVA
DVSTPAMRALLLYLYTGDHDTKVMKEHGMALLTAAHKYDIPDLKRVCETAVANSVKPSNV
IETLQQARLYDATWVKRACVDCIAQNLEKVAFTEEFRNLIFRNDDPEAILDTIQSIAALQ
Download sequence
Identical sequences A9TIP4
jgi|Phypa1_1|93266|fgenesh1_pg.scaffold_240000003 3218.JGI93266 XP_001778510.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]