SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3218.JGI96478 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI96478
Domain Number 1 Region: 603-649
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000559
Family RING finger domain, C3HC4 0.011
Further Details:      
 
Domain Number 2 Region: 197-266
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000038
Family Eukaryotic type KH-domain (KH-domain type I) 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI96478
Sequence length 718
Comment (Physcomitrella patens)
Sequence
MESASTECTHDAASDCGWSLKKLKPHKVQASRALKLRGGPEEQDRHSRRSDVDHALIDHQ
QHLRRLKQSRADIAGSHSSPPRRQRLPPDVENGLPTTAWDFSRPLTSKLVERDGSHQTGH
GLTWSRASTQVGKGATTKKQHQRQSMGAAVESRRRLARGPRSGSTIADGQAGGQSMLPLE
DHRVVSTDYQAAGTQALMRVTLLAAGFVIGARGISVRLIGQVTGAIVQSWTESCRPDSIP
IRLFRIQGKKAVVQTAVALIEQAVVKYKDLCECKRRGEFVQREHVINGVEFYYQPPPRKA
FANNGNELSPKAEDGPGVQLKNHWATAASFPPHHVWLQHLQEQQQHQAQTVAAQQQKQQA
HLSLLEASQGQVVKGENGVDCRGQDPSDVGHQSQVFFDWQPKVERQLIGLQSPDLDRSTE
FVSEFELLDHGLQQSVASLEQALQQVRLEQHLLQRKRTMGNNNNNNNNMTNCNNNDSASH
LHCYQGQKLLNHKNNQIENNGLWPETTSDSPGGQQSTAASTAFHLGPSLFFFEDGGLPLP
ISPTEVRSVADNNCIFMDATPCTPFDFPHNDFLRDSLPNFPRGAARKIPECSLYEASPLL
ENADVSLCIVCIEHQASVQLMPCGHNLFCFSCVGGLLTCPLCRQPIVALHPRGSNPLTPE
VVGLPNDLNVSSHSEWNKVPGAYIITRSEQVQGVAVGPRYSLEACCSEFIIHSRRLSI
Download sequence
Identical sequences A9TSA1
jgi|Phypa1_1|96478|fgenesh1_pg.scaffold_304000004 3218.JGI96478 XP_001781504.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]