SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3218.JGI97923 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI97923
Domain Number 1 Region: 42-143
Classification Level Classification E-value
Superfamily POZ domain 0.0000000000000126
Family BTB/POZ domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI97923
Sequence length 217
Comment (Physcomitrella patens)
Sequence
MVKFLPSLCTSIELNDVQSQLQKIMEKQNFITTWDPETMLPPHTDVILEANDGRLVHAHK
STLMGKSTAFKTLFSATRDVVNPQTVKMDMDHASLEAFIHFFYTGFVKDDLMDSFADKLL
RASDTYGISLLHNLCQEKMMTNIHPERIFQYFLLGSKCHAEQLVHAIISFVANNYSDIAE
INGYDDFLKDDPTLVAKLGNGIVKKLQAKLKNHPKIM
Download sequence
Identical sequences A9TVR9
3218.JGI97923 PP1S338_18V6.1 XP_001782701.1.60028 jgi|Phypa1_1|97923|fgenesh1_pg.scaffold_338000010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]