SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 321967.LSEI_0924 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  321967.LSEI_0924
Domain Number 1 Region: 328-473
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 6.28e-30
Family HD domain 0.012
Further Details:      
 
Domain Number 2 Region: 211-306
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.56e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 321967.LSEI_0924
Sequence length 523
Comment (Lactobacillus casei ATCC 334)
Sequence
MSSVTLVSITLAAVIALAVGLLIGFALQKKLHQNNLDRATQTAEGIIEAAKKEAATLKKE
KLLEAKDENHRYRTQLEDELKDRRTEVQKSEHRLNQREDTLDRRDDTLDRKEQSLADREA
NLNKRQQQLDEREQDISSEISKQHTELERIAELTHEQARQQILDQTQSELTHERAVMIKE
SEDEAKEAADKKAKVLIADAIQRSASDIVAETTVTVVNLPNDDMKGRIIGREGRNIRTLE
TLTGIDLIIDDTPQAVVLSGFDPIRREIARIALEKLIQDGRIHPARIEEMVDKARKEMDD
RIREIGEQAIFDVGIHNMHPDLIKILGRLHFRTSYGQNVLDHSIQVAKLTGVMAAELGED
VTLAKRAGLLHDIGKALDHEVDGSHVEIGVELATKYKEPKTVINAIASHHGDVEPTSVIS
VLVAAADAISAARPGARSESLENYLHRLEKLEAIANSHAGVDHSFAIQAGREVRVIVQPE
KLSDDQSVILARDIRNEIEKELEYPGHIKVTVIRETRTVEYAK
Download sequence
Identical sequences A0A0C9Q9F5 A0A0E2LWC3 A0A0K1KXW8 A0A1F1JTL2 A0A2I5MH27 Q03AP9 S2R556 S2R666 S2TLR9 S2TZV4
gi|191637815|ref|YP_001986981.1| gi|385819554|ref|YP_005855941.1| WP_003657913.1.100311 WP_003657913.1.101073 WP_003657913.1.11857 WP_003657913.1.12579 WP_003657913.1.13158 WP_003657913.1.13224 WP_003657913.1.13963 WP_003657913.1.1450 WP_003657913.1.16432 WP_003657913.1.16871 WP_003657913.1.18077 WP_003657913.1.1932 WP_003657913.1.20005 WP_003657913.1.22898 WP_003657913.1.24721 WP_003657913.1.24722 WP_003657913.1.24935 WP_003657913.1.25941 WP_003657913.1.29319 WP_003657913.1.29913 WP_003657913.1.31893 WP_003657913.1.348 WP_003657913.1.3518 WP_003657913.1.35591 WP_003657913.1.3835 WP_003657913.1.39141 WP_003657913.1.39264 WP_003657913.1.42997 WP_003657913.1.43124 WP_003657913.1.44079 WP_003657913.1.44847 WP_003657913.1.45488 WP_003657913.1.45928 WP_003657913.1.46604 WP_003657913.1.48728 WP_003657913.1.49406 WP_003657913.1.49750 WP_003657913.1.52467 WP_003657913.1.54691 WP_003657913.1.56780 WP_003657913.1.56814 WP_003657913.1.57088 WP_003657913.1.6012 WP_003657913.1.60703 WP_003657913.1.61849 WP_003657913.1.62572 WP_003657913.1.63838 WP_003657913.1.64430 WP_003657913.1.66157 WP_003657913.1.67371 WP_003657913.1.6844 WP_003657913.1.698 WP_003657913.1.7166 WP_003657913.1.7209 WP_003657913.1.73866 WP_003657913.1.74575 WP_003657913.1.74597 WP_003657913.1.75061 WP_003657913.1.78295 WP_003657913.1.7925 WP_003657913.1.8164 WP_003657913.1.82183 WP_003657913.1.86624 WP_003657913.1.88086 WP_003657913.1.90364 WP_003657913.1.91063 WP_003657913.1.916 WP_003657913.1.91737 WP_003657913.1.92090 WP_003657913.1.94863 WP_003657913.1.98897 WP_003657913.1.9892 WP_003657913.1.99959 YP_806165.1.65993 321967.LSEI_0924 543734.LCABL_10370 gi|301065940|ref|YP_003787963.1| gi|116494431|ref|YP_806165.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]