SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 322098.AYWB_470 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  322098.AYWB_470
Domain Number 1 Region: 301-499
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.57e-45
Family Ribonuclease PH domain 1-like 0.0000144
Further Details:      
 
Domain Number 2 Region: 15-142
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.45e-37
Family Ribonuclease PH domain 1-like 0.0000603
Further Details:      
 
Domain Number 3 Region: 460-560
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.31e-26
Family Ribonuclease PH domain 2-like 0.00015
Further Details:      
 
Domain Number 4 Region: 143-229
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.49e-23
Family Ribonuclease PH domain 2-like 0.0034
Further Details:      
 
Domain Number 5 Region: 567-642
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000436
Family Eukaryotic type KH-domain (KH-domain type I) 0.0057
Further Details:      
 
Domain Number 6 Region: 622-703
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000604
Family Cold shock DNA-binding domain-like 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 322098.AYWB_470
Sequence length 715
Comment (Aster yellows witches-broom phytoplasma AYWB)
Sequence
MLKKVFETTNLKDSFQVEIGTYARNVDSSILVRYQDTVVLTTMVFSRKPNNLDFLPLTVI
YQEKLYAAGKIPGSFLRREGRSNDHEILTSRLIDRSLRPLFPDYFQQEVQVINTVLSLDP
DFKSELASMLGSSLSLLISEIPFFEAISGVYVGKINNEFIINPTLQQLANSTLHLIVAGT
KHNVTMIEAHANEVSEQDFLEAINFAHQYIKKLCLFQENIKQQFAPVKMTKTLHQTEQIQ
QQSFFAKNHSQVKQAILSCNSKNDLQQLKEQILDQAKQTPFFKTIDAITVFDYEAHKKHL
QITENLFQKLSKQEMRSLILQEKIRPDKRELEEIRTLESQIDLLPRAHGSALFTRGKTQS
LAAVTLGCLSESKIIDGLSDEQNKRFMLHYNFPPFSVGAVGRYTAPSRREIGHGTLAEKA
ISQVLPEEKDFPYTIRVVSEILESNGSSSQATVCSSSLALMASGVPLKKAVAGISVGLVF
DQETNKYVILSDIQGLEDHVGDMDLKIAGTNKGITALQMDLKIQGIPFKILQEAFLQAKK
GRLHILEQMNQTISQPRLEVSKYAPKVCMMQIKPEKIRDIIGSGGKIINQIIESHDGVKI
DIEQDGRVFVMHSNLETVKKTVAFIESLIQEIQVGTCYQASILRFLSDKQGKMIGAVAQV
CPGIEGLIHVNKMKFQKITDVLKIGETVLVKCTKINERGRIDFLLLPKKTQEKNS
Download sequence
Identical sequences Q2NJ06
gi|85057750|ref|YP_456666.1| WP_011412751.1.27578 322098.AYWB_470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]