SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 323097.Nham_2920 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  323097.Nham_2920
Domain Number - Region: 37-90
Classification Level Classification E-value
Superfamily Prefoldin 0.0392
Family Prefoldin 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 323097.Nham_2920
Sequence length 118
Comment (Nitrobacter hamburgensis X14)
Sequence
MTGRSLPWALMIAIACVLRPGAAPAQDVPGIEICTAEKTMERRTSCLQSNVNFLQGTTSR
LAIDSQQKIDAANRRIGALEGTVAELQKAVAELQAARKKQPQPPAKEDGKDNAKENGK
Download sequence
Identical sequences Q1QJB0
gi|92118418|ref|YP_578147.1| 323097.Nham_2920 2005176754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]