SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 323097.Nham_3807 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  323097.Nham_3807
Domain Number - Region: 43-110
Classification Level Classification E-value
Superfamily POZ domain 0.00292
Family Tetramerization domain of potassium channels 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 323097.Nham_3807
Sequence length 117
Comment (Nitrobacter hamburgensis X14)
Sequence
MFRLGADLKVYLHREPIDFRAGINSLAVLVQETMALDPFAPAVFAFCNRRRDRMKLLFFD
RSGFVLVLKRLTEDKFRWPRREAAVVRLTTEQLHWILDGIDIDAMVRHPLRQYQVAG
Download sequence
Identical sequences Q1QGY0
323097.Nham_3807 gi|92119248|ref|YP_578977.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]