SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 323098.Nwi_0385 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  323098.Nwi_0385
Domain Number 1 Region: 93-263
Classification Level Classification E-value
Superfamily PRTase-like 5.11e-31
Family Phosphoribosylpyrophosphate synthetase-like 0.054
Further Details:      
 
Weak hits

Sequence:  323098.Nwi_0385
Domain Number - Region: 41-68
Classification Level Classification E-value
Superfamily YfgJ-like 0.0379
Family YfgJ-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 323098.Nwi_0385
Sequence length 271
Comment (Nitrobacter winogradskyi Nb-255)
Sequence
MELSTDNLFSPHPARLLRGAWRACRETMSYAARTALDIALPTLCVACREPVAGVGVCADC
WTKLSFIERPYCPRLGTPFVYDPGSEMLSMEAIANPPAYQRARAAVRYDDVAKVLVHALK
YQDRTDLAPVMGRWMARAGSGLLDGADLLIPVPLHWRRGWSRRFNQSGMLARVIARHSGV
PVAPDTLRRIRPTRQQVRLSRNDRARNVQGAFKVTAERAGHVQGRRVILIDDVLTSGATV
DACARVLLRAKAAQVDVLVFARVVDTMKAPI
Download sequence
Identical sequences Q3SVN9
WP_011313716.1.37845 gi|75674583|ref|YP_317004.1| 323098.Nwi_0385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]