SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 323098.Nwi_0675 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  323098.Nwi_0675
Domain Number 1 Region: 23-144
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.4e-26
Family cAMP-binding domain 0.038
Further Details:      
 
Domain Number 2 Region: 159-237
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.4e-19
Family CAP C-terminal domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 323098.Nwi_0675
Sequence length 240
Comment (Nitrobacter winogradskyi Nb-255)
Sequence
MNAAARSALFMSETIESLNVGARFLDRLSVEQRAQVRAAGRGLVVRQGDPVFSQGEHHDG
IFIIDRGQVRVYYSAPSGREITLAYWTPGHFIGGPGVSGGGVYMWSGVAIEDCAITMLPS
AVLRKLLLQMPDFALAMIDGLIAKGECYSSMAQMLGTRSVIERLAQYLVNLSELYGIDGG
DAIIINRKVTHDQIAAMVGSTRQWVTMMLKRFQNEQIIAIDGNIMRIKRLDMLKKILFRE
Download sequence
Identical sequences Q3SUV0
323098.Nwi_0675 gi|75674872|ref|YP_317293.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]