SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 323259.Mhun_2465 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  323259.Mhun_2465
Domain Number 1 Region: 80-172
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.47e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00032
Further Details:      
 
Domain Number 2 Region: 6-70
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000167
Family Eukaryotic type KH-domain (KH-domain type I) 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 323259.Mhun_2465
Sequence length 179
Comment (Methanospirillum hungatei JF-1)
Sequence
MQQETRITQERIGVLIGKKGLTKREIEEKTKTRIQVDSEEGLVSIEGEDADGFIQAVETV
KAIARGFSPERAAILLEDPDLYLEIIELSEYAGSDSKIERIRGRIIGRDGRSRAQIQDMT
ATEISVYGKTVGIIGTIEQVKIAREAVEMLIKGVSHESVFSFLEKKRRELKQDMISYYY
Download sequence
Identical sequences Q2FN99
WP_011449423.1.85653 gi|88603706|ref|YP_503884.1| 323259.Mhun_2465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]