SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 323259.Mhun_2712 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  323259.Mhun_2712
Domain Number 1 Region: 1-145
Classification Level Classification E-value
Superfamily PIN domain-like 0.00000000000000151
Family PIN domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 323259.Mhun_2712
Sequence length 154
Comment (Methanospirillum hungatei JF-1)
Sequence
MDIFIDTSVIIPFLIESPATMEVRGFFENFHGSFHTCSMVYQETLFIGMRLIAVERLKIR
SYIDLKEYIIKNGHSFADDFYEKVSLLFGNMTIHRDSADTDHIMQLMVDYGLFPADAVIA
ATSIEQKITLFASRDKDYSRICYLKLFPFNENFR
Download sequence
Identical sequences Q2FTD9
gi|88603948|ref|YP_504126.1| 323259.Mhun_2712

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]