SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 323261.Noc_0106 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  323261.Noc_0106
Domain Number 1 Region: 3-179
Classification Level Classification E-value
Superfamily TPR-like 7.96e-62
Family Atu0120-like 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 323261.Noc_0106
Sequence length 184
Comment (Nitrosococcus oceani ATCC 19707)
Sequence
MLLNSMHHQQIIDFWFKEIKPESWWKKIPHFDQLIKERFKAHHRAAVQGELYEWRREPFG
RLAEIIILDQFSRNIYRNHPLSFAYDTAALILSQEAIDKNVGKMLNSEHKIFLYMPFMHS
ESLKIHQIGIKLFAEPGLESQYDCEIKHQAIITRFGRYPHRNQILERPSTPAEIAFLKKA
DSSF
Download sequence
Identical sequences A0A0E2Z621 Q3JEV7
gi|77163644|ref|YP_342169.1| WP_002812165.1.20919 WP_002812165.1.77844 WP_002812165.1.91979 323261.Noc_0106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]