SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 323261.Noc_3078 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  323261.Noc_3078
Domain Number 1 Region: 62-121
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit B, membrane domain 0.000000000000111
Family F1F0 ATP synthase subunit B, membrane domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 323261.Noc_3078
Sequence length 156
Comment (Nitrosococcus oceani ATCC 19707)
Sequence
MNVTVTLIGQMVAFGILVWFVNRFLWGPLTNLMEERKKRVADGLAAAERGKHERELAEKR
AKETLHEAKEKAAEIITQAQKRAGEIIEEAKEAAQAEGERLKVSANAEIQQEMNRAREDL
RGQVVSIAVAGASKILKRELDEKANEALVKELVAQI
Download sequence
Identical sequences A0A0E2Z3E4 Q3J6M7
WP_011331143.1.20919 WP_011331143.1.60716 WP_011331143.1.77844 WP_011331143.1.91979 323261.Noc_3078 gi|77166524|ref|YP_345049.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]