SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 323848.Nmul_A1259 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  323848.Nmul_A1259
Domain Number - Region: 69-127
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0353
Family Galacturonase 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 323848.Nmul_A1259
Sequence length 208
Comment (Nitrosospira multiformis ATCC 25196)
Sequence
MNNFSKIAIAALTFGGSISAASAAGVITNITASGDGLGSFNYTIDDTNRVLDLTKVFNSV
DPIVLTFTVEHSTGPGNPYTVKEAVINSSSQLWTDFHYTIGEPDRGNGVVFTQHNNSVLS
GFSLDQSSGPRNLDFSGSLASGDPAVTAGFMISPFDPGQGNTMTFTITQAPTIGQVPPVP
EPETYAMLLAGLGLMGVMVKGRNSKKSA
Download sequence
Identical sequences A0A1H3ZFR0 Q2Y9K9
323848.Nmul_A1259 WP_011380603.1.10075 WP_011380603.1.92891 gi|82702388|ref|YP_411954.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]