SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 323848.Nmul_A1524 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  323848.Nmul_A1524
Domain Number 1 Region: 2-227
Classification Level Classification E-value
Superfamily DNase I-like 3.53e-38
Family DNase I-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 323848.Nmul_A1524
Sequence length 228
Comment (Nitrosospira multiformis ATCC 25196)
Sequence
MQMTLATYNIHGCIGADGRFKPDRIIDVLQEMNADIIALQEVEHHQVEGYDLLDYFAVKT
GFTAIAGPTLVRRTHHYGNALLTKLPVLAVNRIDLTLPGREPRGALDVTLAWNDRRVHVV
ATHLGLRPSERRQQVRHLLKLFEIRLTEIYVLMGDLNEWFLWGRPLRWLHAHFKRPPHCA
TFPARKPFMALDRLWVHPRRRLKSLEAHSSSLARIASDHLPLKAIIEI
Download sequence
Identical sequences Q2Y8U4
323848.Nmul_A1524 gi|82702653|ref|YP_412219.1| WP_011380858.1.10075 WP_011380858.1.92891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]