SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 323848.Nmul_A1773 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  323848.Nmul_A1773
Domain Number 1 Region: 50-164
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.75e-24
Family cAMP-binding domain 0.01
Further Details:      
 
Domain Number 2 Region: 167-246
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 6.53e-17
Family CAP C-terminal domain-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 323848.Nmul_A1773
Sequence length 263
Comment (Nitrosospira multiformis ATCC 25196)
Sequence
MSKHALKLIPSSTEHADVPNDCKNCGAYHLCMSLWLKTADSSLLERVVKKKQVFKRGEVL
YRMGQPLEYIYVIRGGSVKTCVSTEDGQVQVMGFHAAGELLGLNAISNREHKCEARAMGV
TSVCEVSVERFEELAKKDPAIQYEILKIMSAEIHHGQELLLLLGKHNAEERIAIFLLNLS
RQFEQRHCSATEFTLCMSRSDIGNYLGIAEETVCRIFARFQDDGLISSEYRNVKLKDIKR
LEQIANQRPQRSLRQTNVASLYF
Download sequence
Identical sequences Q2Y851
WP_011381090.1.10075 gi|82702896|ref|YP_412462.1| 323848.Nmul_A1773 391081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]