SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 324057.Pjdr2_2206 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  324057.Pjdr2_2206
Domain Number 1 Region: 31-123
Classification Level Classification E-value
Superfamily Coiled-coil domain of nucleotide exchange factor GrpE 3.66e-26
Family Coiled-coil domain of nucleotide exchange factor GrpE 0.00095
Further Details:      
 
Domain Number 2 Region: 124-178
Classification Level Classification E-value
Superfamily Head domain of nucleotide exchange factor GrpE 1.83e-19
Family Head domain of nucleotide exchange factor GrpE 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 324057.Pjdr2_2206
Sequence length 179
Comment (Paenibacillus JDR 2)
Sequence
MVSNDQHNETIDEVIEEQQTEQQEESGAQEDPRIEELTKLAEENQQRYLRAQADFDNFRR
RTQKEKEDLAQYASMKLIGQLLPVVDNFERAVAAASANQDFEALAKGVDMIFRQLEQTLQ
QEGLKAMDAVGEPFNPEFHQAIMTVESDEHEEGIIVEEVQKGYILKERVLRPAMVKVSG
Download sequence
Identical sequences C6CTS1
WP_015843807.1.29859 gi|251796217|ref|YP_003010948.1| 324057.Pjdr2_2206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]