SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 324057.Pjdr2_2965 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  324057.Pjdr2_2965
Domain Number 1 Region: 23-200
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 6.18e-43
Family Pentapeptide repeats 0.0000943
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 324057.Pjdr2_2965
Sequence length 201
Comment (Paenibacillus JDR 2)
Sequence
MFQYNDQTYTGVNFGAQDLRFGELINCTFVRCSFAGGSLEELSSINCRFVECDFRGAMLN
GSIHKESAFENCNFSGANLFVVKFDACKMTGSDFTNSTMDGISIIQGDWSYTNLRHARLV
KQDLRGIKFHEADLSGANLEKADLRDSDLSMAVLAKAKLQDTDVRGAKMEGVDFKSISVA
GLRMDREQTVLFAMSHGAKIK
Download sequence
Identical sequences C6D063
WP_015844555.1.29859 324057.Pjdr2_2965 gi|251796967|ref|YP_003011698.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]