SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 324057.Pjdr2_3401 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  324057.Pjdr2_3401
Domain Number 1 Region: 291-486
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.59e-48
Family Ribonuclease PH domain 1-like 0.0000129
Further Details:      
 
Domain Number 2 Region: 5-140
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.77e-47
Family Ribonuclease PH domain 1-like 0.0000192
Further Details:      
 
Domain Number 3 Region: 448-545
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.82e-26
Family Ribonuclease PH domain 2-like 0.00012
Further Details:      
 
Domain Number 4 Region: 141-231
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.4e-26
Family Ribonuclease PH domain 2-like 0.0015
Further Details:      
 
Domain Number 5 Region: 553-638
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.93e-23
Family Eukaryotic type KH-domain (KH-domain type I) 0.0029
Further Details:      
 
Domain Number 6 Region: 619-692
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.72e-20
Family Cold shock DNA-binding domain-like 0.00055
Further Details:      
 
Domain Number 7 Region: 234-318
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 5.23e-16
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 324057.Pjdr2_3401
Sequence length 698
Comment (Paenibacillus JDR 2)
Sequence
MQRVEMLLGGRTLVLETGRLAKQANAAVTVRYGDTVVLCTVTASAEPKDLDFFPLTVNYE
ERLYAVGKIPGGFIKREGRPSEKAILSSRLTDRPIRPLFPEGFRNDVQVANIVMSVDQNC
TPEIAAMIGTSAALSISDVPFNGPIGGVNVGRVNGQFIINPTVEQEAETEIFVTVAGTKD
AIMMVEAEGNEVAEDVMLEAIMFGHDEIKKIVAMIEELQAAAGKPKMEVKLHAVNAEVNA
AVRAFASDKLVEAIRIPEKHARQDAIDAVNGDTVAHFEEVYAETPELLADVKEVLYDIVK
EEVRRLITHDKVRPDGRALEEIRPIECDVALLPRTHGSGLFTRGQTQALSICTLGALGDV
QILDGISPEETKRFMHHYNFPPFSVGEARPLRPPGRREIGHGALGERALSKVIPSETEFP
YTIRLVSEVLESNGSTSQASICASTLAMMDAGVPIKAPVAGIAMGLIKDGDHFSILSDIQ
GMEDHLGDMDFKVAGTAQGVTAIQMDIKINGIDRAILSQALEQARIGRMHILGKMTAVMS
QSRSSLSQYAPKILTLRINPDKIRDVIGSGGKIINKIIEETGVKIDIEQDGMVFIASSNE
EMNQKAKAIIEGIVKEVVIGEVYLGTVKRIEKFGAFVEILPNKDGLVHISQLSTERVAKV
EDVVAIGDQITVKVTEIDQQGRINLSRKAVLTPQVPAQ
Download sequence
Identical sequences C6D2E6
324057.Pjdr2_3401 gi|251797391|ref|YP_003012122.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]