SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 324602.Caur_1455 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  324602.Caur_1455
Domain Number - Region: 7-45
Classification Level Classification E-value
Superfamily post-AAA+ oligomerization domain-like 0.00561
Family DNA polymerase III clamp loader subunits, C-terminal domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 324602.Caur_1455
Sequence length 87
Comment (Chloroflexus aurantiacus J 10 fl)
Sequence
MTLEEALIAALAAGDRSRAIEIATELHARGIDVQAIEAALAAQPQLEEQLWATLNEVIPI
SRRALKRRAIRAAEERDWGNWEEGRRR
Download sequence
Identical sequences A9WAC4
gi|222524851|ref|YP_002569322.1| gi|163847028|ref|YP_001635072.1| 324602.Caur_1455 480224.Chy400_1578 WP_012257339.1.35445 YP_001635072.1.55443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]