SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 324602.Caur_1605 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  324602.Caur_1605
Domain Number 1 Region: 6-96
Classification Level Classification E-value
Superfamily SMAD/FHA domain 1.26e-19
Family FHA domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 324602.Caur_1605
Sequence length 99
Comment (Chloroflexus aurantiacus J 10 fl)
Sequence
MSRELTLIGVSGSRTGQQIVVNRRSMVIGSARQCDIVLHDRQVLERHAEIVQALERWFVA
PLDGSALVALNGQRISSRQRLQNGDLLSIGSATFKVADR
Download sequence
Identical sequences A9WBL6
WP_012257477.1.35445 YP_001635212.1.55443 gi|163847168|ref|YP_001635212.1| gi|222525007|ref|YP_002569478.1| 324602.Caur_1605 480224.Chy400_1742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]