SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 324925.Ppha_0666 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  324925.Ppha_0666
Domain Number 1 Region: 309-505
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.33e-50
Family Ribonuclease PH domain 1-like 0.0000184
Further Details:      
 
Domain Number 2 Region: 12-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 9.62e-44
Family Ribonuclease PH domain 1-like 0.0000552
Further Details:      
 
Domain Number 3 Region: 467-565
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.38e-26
Family Ribonuclease PH domain 2-like 0.00011
Further Details:      
 
Domain Number 4 Region: 145-236
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 4.49e-25
Family Ribonuclease PH domain 2-like 0.002
Further Details:      
 
Domain Number 5 Region: 572-657
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.63e-21
Family Eukaryotic type KH-domain (KH-domain type I) 0.0018
Further Details:      
 
Domain Number 6 Region: 626-716
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.79e-16
Family Cold shock DNA-binding domain-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 324925.Ppha_0666
Sequence length 728
Comment (Pelodictyon phaeoclathratiforme BU 1)
Sequence
MIINKEIDLGQGKIISIETGKMAKQADGAVVVRQGDTMVIATVVSSKKTPPPNQDYFPLQ
VEYREKYSAAGKFPGGFFKRESRPSEKEILSARLIDRALRPLFPDGYLYETQIIVTVISS
DQINDADVLGGLAASCAIMVSDIPFQNPMSEVRVGRINGLFVVNPDINELVNSDLDICIG
GTENTICMLEGEMKEISEAEMLDAIKFGHAAIRKLCALQSEIAAEVAKPIRPFTPTVIPA
ELTETVRVLCETRLKELAYTPLKKEERADQTAAIYHEIIESTIEHFKATCSSEEFSTDPA
KALCINPHIIDEQIHMVEKRVMRHMILDDAKRLDGRALDQVRPISIELGIIPRAHGSALF
TRGETQALVTITLGTKKDAQSVDNLTSSADKKFYLHYNFPPFCVGETGRLGSIGRREIGH
GNLAERSIKMVAPTEEEFPYTIRIVSDILESNGSSSMASVCGGTLALMDGGVPIKKPVSG
IAMGLIKEGASYAVLSDILGNEDHLGDMDFKVSGTRDGITACQMDIKIDGLDYHILETAL
EQARRGRLHILGEMEKAIPSTRQELANFAPKLTSIKVPVDCIGMIIGKGGETIRSITEET
GAEINIDDDGTITIACSTSEGTNAALATIKNLTAKPEVGNIYIGKVRDIRDELGAFVEFL
PKTDGLVHISEISSERVTKVSDHLKIGEKVRVKLVDVRKDSRTGKTRFALSIKAAEQDAP
KENGAENK
Download sequence
Identical sequences B4SDX4
WP_012507460.1.90574 gi|194335788|ref|YP_002017582.1| 324925.Ppha_0666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]