SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 325240.Sbal_2394 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  325240.Sbal_2394
Domain Number 1 Region: 78-174
Classification Level Classification E-value
Superfamily HSC20 (HSCB), C-terminal oligomerisation domain 5.62e-23
Family HSC20 (HSCB), C-terminal oligomerisation domain 0.00079
Further Details:      
 
Domain Number 2 Region: 1-74
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.7e-16
Family Chaperone J-domain 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 325240.Sbal_2394
Sequence length 174
Comment (Shewanella baltica OS155)
Sequence
MNYFELFKFSPAFDIDTALLAERYRELQRAVHPDKFANDTEQQKLLSVQRTAQVNDGFQT
LKDPIRRAEHMLSLRGIELSHETTTVKDTGFLMQQMEWREALEDIRDSADPQASIDALYQ
SFAEYRAQLTQQLTQLLTSEQAEDALLAADQVRKLKFMAKLHDELTRVEDALLD
Download sequence
Identical sequences A3D574
gi|126174607|ref|YP_001050756.1| gi|386341364|ref|YP_006037730.1| 325240.Sbal_2394 WP_011846946.1.8014 WP_011846946.1.86146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]