SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 325240.Sbal_3234 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  325240.Sbal_3234
Domain Number 1 Region: 5-146
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.95e-50
Family Ribonuclease PH domain 1-like 0.0000212
Further Details:      
 
Domain Number 2 Region: 301-494
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.58e-46
Family Ribonuclease PH domain 1-like 0.0000197
Further Details:      
 
Domain Number 3 Region: 452-550
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 7.99e-28
Family Ribonuclease PH domain 2-like 0.00011
Further Details:      
 
Domain Number 4 Region: 147-237
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.38e-27
Family Ribonuclease PH domain 2-like 0.00086
Further Details:      
 
Domain Number 5 Region: 556-642
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.15e-22
Family Eukaryotic type KH-domain (KH-domain type I) 0.0043
Further Details:      
 
Domain Number 6 Region: 622-699
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.11e-21
Family Cold shock DNA-binding domain-like 0.0001
Further Details:      
 
Domain Number 7 Region: 241-322
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 5.23e-17
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 325240.Sbal_3234
Sequence length 703
Comment (Shewanella baltica OS155)
Sequence
MGHVNPIVKSFEYGQHTVTLETGVIARQADAAVLASMGDTTVLVTVVGKKEADAGRDFFP
LTVNYQEKTYAAGKIPGGFFKREGRPSEDETLIARLIDRPIRPLFPNGFKNEVQVIITVV
SVDPQIEPDIISMIGTSAALAISGIPFSGPLGAARVGYIDGEYVLNPSVAQLATSQLNLV
VAGTAGAVLMVESEAQALPEEVMLGSVVYGHDQQQVVIKAIAEFKAEAGKPTWDWTAPTQ
DADLVAQIKELAEAGLGDAYKIQVKQDRYAQVSVVKAATKEALLASNPSIDLREVDNLLG
SLEKKVVRGRIIRGEPRIDGREPDMIRALSVLAGVLPRTHGSALFTRGETQALVTCTLGT
ERDAQKIDSIMGERTNRFMLHYNFPPYSVGETGMVGSPKRREIGHGKLAWRGINAVMPSA
AEFPYSVRVVSEITESNGSSSMASVCGTSLALMDAGVPIKTSVAGIAMGLVKEGDDFVVL
SDILGDEDHLGDMDFKVAGTRDGITALQMDIKIEGITKEIMDIALQQAYGARVHILNVMD
QAIGSHRDDISDHAPRITVIKINPEKIRDVIGKGGAVIRALTEETGTTIELEDDGTVKIA
SSNGEATKEAIRRIEEITSEVEVGRIYNGKVIRIVDFGAFVNILPGKDGLVHISQISDER
VANVSDHLELNQEVAVKVMEVDRQGRVRLSIKEAQTKETAAAE
Download sequence
Identical sequences gi|126175434|ref|YP_001051583.1| 325240.Sbal_3234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]