SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 326297.Sama_2692 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  326297.Sama_2692
Domain Number 1 Region: 1-103
Classification Level Classification E-value
Superfamily PUA domain-like 2.82e-34
Family yqfB-like 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 326297.Sama_2692
Sequence length 109
Comment (Shewanella amazonensis SB2B)
Sequence
MHPTKITFYERFEPIILSGDKTITIRDEAESHYVPGTRVAVHTYETDRWFCDIEIGSVTP
IQFDALNEEHARQEHLSLKDLKAVIRDIYPELDSLYVIEYRLISASQAG
Download sequence
Identical sequences A1S938
WP_011760800.1.25267 gi|119775824|ref|YP_928564.1| 326297.Sama_2692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]