SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 326298.Suden_1009 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  326298.Suden_1009
Domain Number 1 Region: 33-104
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000011
Family Filamentous hemagglutinin FhaB, secretion domain 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 326298.Suden_1009
Sequence length 122
Comment (Thiomicrospira denitrificans ATCC 33889)
Sequence
MKYNPDFSSRFRILKGGKISLVVSALIGSITILSASPTGGVVTSGVANISQSGAITNITQ
STNKATINWQNFSIGANETVNFAQPNVNAIALNRIVGNERSVIESTKRKRTSLDTKLKRC
AF
Download sequence
Identical sequences Q30RU4
gi|78777207|ref|YP_393522.1| 326298.Suden_1009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]