SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 326423.RBAM_002830 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  326423.RBAM_002830
Domain Number - Region: 4-51
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0245
Family Calponin-homology domain, CH-domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 326423.RBAM_002830
Sequence length 68
Comment (Bacillus amyloliquefaciens FZB42)
Sequence
MTARTGLIFSALIHGLHPPHIFVNENQHVTEWQAAYPVETAKFALQTGQEEHMQMARDML
GLTDPKGY
Download sequence
Identical sequences A7Z106
326423.RBAM_002830 gi|154684752|ref|YP_001419913.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]