SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 326423.RBAM_016060 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  326423.RBAM_016060
Domain Number - Region: 18-133
Classification Level Classification E-value
Superfamily OmpH-like 0.0222
Family OmpH-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 326423.RBAM_016060
Sequence length 208
Comment (Bacillus amyloliquefaciens FZB42)
Sequence
MAFAKAEADRVSEEAKNQFEHTLRQIEEEKNRWAEEKQRLIEEAKAEGYEEGMALGKAEA
QAEYANLISRANAVMEMARQSVEEKLESAEEEIIELSVALAKKVWRQKSDDKEAFLLLVK
QVVAEVKDYDDISIYVDPEYYVTVHQHMDEIQQLLYKECRLSLYADEKAAKGTCSIETPF
GRVDAGIDTQLMQLKQKLLTALEAGAEQ
Download sequence
Identical sequences A7Z4P3
gi|154686039|ref|YP_001421200.1| 326423.RBAM_016060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]