SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 326424.FRAAL3633 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  326424.FRAAL3633
Domain Number - Region: 21-161
Classification Level Classification E-value
Superfamily Xylose isomerase-like 0.000149
Family KguE-like 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 326424.FRAAL3633
Sequence length 217
Comment (Frankia alni ACN14a)
Sequence
MDAPGSRPAGRRARRATRRTARRRWVLRGFAAAGAADWSDRAARYRRRNTRDALDVLVAN
VRIACAQLPVPLALENPAALLRWPDGELAPADFLAELAERTGALLLVDVANLHGDAVNHG
LDPVAAFDRLPWERVAYLHVAGGSMHEGRYHDTHLHPVGAPQLELLADAVRRCPPGRAAY
LLERDGRYPPAAEFHAECDRVQPAAAHAERQLPWQPQ
Download sequence
Identical sequences Q0RJN6
WP_011604772.1.38265 326424.FRAAL3633 gi|111223043|ref|YP_713837.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]