SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 326427.Cagg_2418 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  326427.Cagg_2418
Domain Number 1 Region: 2-109
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.24e-22
Family Anti-sigma factor antagonist SpoIIaa 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 326427.Cagg_2418
Sequence length 111
Comment (Chloroflexus aggregans DSM 9485)
Sequence
MNTEQVDDVLIIQLPARLDAAGVAAIESDLASTITGHGGKVLADMTNVNFVASLALRMLL
SNLRAIQPLGGDLRLYGLQPQIAEIFRKSRFDTLFKIYPDRETALAAYRNR
Download sequence
Identical sequences A0A2J6XAA5 B8G3B8
gi|219849294|ref|YP_002463727.1| 326427.Cagg_2418 WP_015941149.1.86148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]